Lineage for d4wtbb_ (4wtb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733155Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (9 PDB entries)
    Uniprot Q8AXY1 17-138
  8. 2733168Domain d4wtbb_: 4wtb B: [279355]
    automated match to d4k06a_
    complexed with cl, so4, zn

Details for d4wtbb_

PDB Entry: 4wtb (more details), 2.16 Å

PDB Description: bthtx-i, a svpla2s-like toxin, complexed with zinc ions
PDB Compounds: (B:) Basic phospholipase A2 homolog bothropstoxin-1

SCOPe Domain Sequences for d4wtbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wtbb_ a.133.1.2 (B:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckladp
c

SCOPe Domain Coordinates for d4wtbb_:

Click to download the PDB-style file with coordinates for d4wtbb_.
(The format of our PDB-style files is described here.)

Timeline for d4wtbb_: