SCOPe 2.05: Domain d4wtba_: 4wtb A:

Lineage for d4wtba_ (4wtb A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Bothrops brazili [TaxId:157546] [228951] (2 PDB entries)

8. Domain d4wtba_: 4wtb A: [279354]
   automated match to d4k06a_
   complexed with cl, so4, zn

Details for d4wtba_

PDB Entry: 4wtb, 2.16 Å

PDB Description: bthtx-i, a svpla2s-like toxin, complexed with zinc ions

PDB Compounds: (A:) Basic phospholipase A2 homolog bothropstoxin-1

SCOPe Domain Sequences for d4wtba_:

Sequence; same for both SEQRES and ATOM records:

>d4wtba_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops brazili [TaxId: 157546]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckladp
c

Timeline for d4wtba_:

• d4wtba_ is new in SCOPe 2.05-stable
  
• d4wtba_ appears in SCOPe 2.06
  
• d4wtba_ appears in the current release, SCOPe 2.08