SCOPe 2.08: Domain d4r6bc1: 4r6b C:1-223

Lineage for d4r6bc1 (4r6b C:1-223)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries)

8. Domain d4r6bc1: 4r6b C:1-223 [279342]
   Other proteins in same PDB: d4r6bc2
   automated match to d2vvhc_
   complexed with so3, so4

Details for d4r6bc1

PDB Entry: 4r6b, 2 Å

PDB Description: rational design of enhanced photoresistance in a photoswitchable fluorescent protein

PDB Compounds: (C:) Green to red photoconvertible GFP-like protein EosFP

SCOPe Domain Sequences for d4r6bc1:

Sequence; same for both SEQRES and ATOM records:

>d4r6bc1 d.22.1.0 (C:1-223) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsrttykak
ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

Timeline for d4r6bc1:

• d4r6bc1 first appeared in SCOPe 2.05, called d4r6bc_
  
• d4r6bc1 appears in SCOPe 2.07