SCOP 1.75: Domain d1hvaa_: 1hva A:

Lineage for d1hvaa_ (1hva A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (218 PDB entries)
   Uniprot P00918

8. Domain d1hvaa_: 1hva A: [27934]
   mutant

Details for d1hvaa_

PDB Entry: 1hva, 2.3 Å

PDB Description: engineering the zinc binding site of human carbonic anhydrase ii: structure of the his-94-> cys apoenzyme in a new crystalline form

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1hvaa_:

Sequence; same for both SEQRES and ATOM records:

>d1hvaa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfcfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1hvaa_:

• d1hvaa_ first appeared (with stable ids) in SCOP 1.55, called d1hva__
  
• d1hvaa_ appears in SCOP 1.73
  
• d1hvaa_ appears in SCOPe 2.01
  
• d1hvaa_ appears in the current release, SCOPe 2.08