SCOP 1.63: Domain d1hva__: 1hva -

Lineage for d1hva__ (1hva -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (9 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (151 PDB entries)

8. Domain d1hva__: 1hva - [27934]
   mutant

Details for d1hva__

PDB Entry: 1hva, 2.3 Å

PDB Description: engineering the zinc binding site of human carbonic anhydrase ii: structure of the his-94-> cys apoenzyme in a new crystalline form

SCOP Domain Sequences for d1hva__:

Sequence; same for both SEQRES and ATOM records:

>d1hva__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfcfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1hva__:

• d1hva__ first appeared (with stable ids) in SCOP 1.55
  
• d1hva__ appears in SCOP 1.61
  
• d1hva__ appears in SCOP 1.65
  
• d1hva__ appears in the current release, SCOPe 2.08, called d1hvaa_