Lineage for d5fl4c_ (5fl4 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2068693Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2068694Protein automated matches [191011] (13 species)
    not a true protein
  7. 2068743Species Human (Homo sapiens) [TaxId:9606] [188766] (12 PDB entries)
  8. 2068756Domain d5fl4c_: 5fl4 C: [279324]
    automated match to d3iaia_
    complexed with 9fk, acy, gol, zn

Details for d5fl4c_

PDB Entry: 5fl4 (more details), 1.82 Å

PDB Description: three dimensional structure of human carbonic anhydrase ix in complex with 5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl) thiophene-2-sulfonamide
PDB Compounds: (C:) Carbonic anhydrase 9

SCOPe Domain Sequences for d5fl4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fl4c_ b.74.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
lngrvieasfp

SCOPe Domain Coordinates for d5fl4c_:

Click to download the PDB-style file with coordinates for d5fl4c_.
(The format of our PDB-style files is described here.)

Timeline for d5fl4c_: