SCOPe 2.06: Domain d5fl4a_: 5fl4 A:

Lineage for d5fl4a_ (5fl4 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188766] (12 PDB entries)

8. Domain d5fl4a_: 5fl4 A: [279321]
   automated match to d3iaia_
   complexed with 9fk, acy, gol, zn

Details for d5fl4a_

PDB Entry: 5fl4, 1.82 Å

PDB Description: three dimensional structure of human carbonic anhydrase ix in complex with 5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl)thiophene-2-sulfonamide

PDB Compounds: (A:) Carbonic anhydrase 9

SCOPe Domain Sequences for d5fl4a_:

Sequence; same for both SEQRES and ATOM records:

>d5fl4a_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
lngrvieasfp

Timeline for d5fl4a_:

• d5fl4a_ first appeared in SCOPe 2.05
  
• d5fl4a_ appears in SCOPe 2.07
  
• d5fl4a_ appears in the current release, SCOPe 2.08