Lineage for d5e8la_ (5e8l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011027Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279296] (3 PDB entries)
  8. 2011030Domain d5e8la_: 5e8l A: [279304]
    automated match to d3ts7b_

Details for d5e8la_

PDB Entry: 5e8l (more details), 2.81 Å

PDB Description: crystal structure of geranylgeranyl pyrophosphate synthase 11 from arabidopsis thaliana
PDB Compounds: (A:) Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic

SCOPe Domain Sequences for d5e8la_:

Sequence, based on SEQRES records: (download)

>d5e8la_ a.128.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sfdfmsyiitkaelvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvgg
eestampaacavemihtmslihddlpcmdnddlrrgkptnhkvfgedvavlagdallsfa
fehlasatssdvvspvrvvravgelakaigteglvagqvvdissegldlndvglehlefi
hlhktaalleasavlgaivgggsddeierlrkfarcigllfqvvddildvtksskelgkt
agkdliadkltypkimgleksrefaeklnreardqllgfdsdkvapllalanyiayrq

Sequence, based on observed residues (ATOM records): (download)

>d5e8la_ a.128.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sfdfmsyiitkaelvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvgg
eestampaacavemihtmslihddlpcmdnddlrrgkptnhkvfgedvavlagdallsfa
fehlasatssdvvspvrvvravgelakaigteglvagqvvdisvglehlefihlhktaal
leasavlgaivgggsddeierlrkfarcigllfqvvddildvtkliadkltypkimglek
srefaeklnreardqllgfdsdkvapllalanyiayrq

SCOPe Domain Coordinates for d5e8la_:

Click to download the PDB-style file with coordinates for d5e8la_.
(The format of our PDB-style files is described here.)

Timeline for d5e8la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5e8lb_