Lineage for d5e8kb_ (5e8k B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (37 species)
    not a true protein
  7. 2011027Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279296] (3 PDB entries)
  8. 2011033Domain d5e8kb_: 5e8k B: [279299]
    automated match to d3kraa_

Details for d5e8kb_

PDB Entry: 5e8k (more details), 3.03 Å

PDB Description: crystal structure of polyprenyl pyrophosphate synthase 2 from arabidopsis thaliana
PDB Compounds: (B:) Geranylgeranyl pyrophosphate synthase 10, mitochondrial

SCOPe Domain Sequences for d5e8kb_:

Sequence, based on SEQRES records: (download)

>d5e8kb_ a.128.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fkfmsymvnkaksvnkaleeavplrepelkireamrytllsdgkrvrpmlclaacelvgg
qestamsaacaiemlhasslilddlpcmdndslrrgkptnhivfgesiailasqaliala
vqkttsstfadvpperilktvqemvkaveglvagqqadlagegmrfdsdtglehlefihi
hktaalleaaavmgaimgggsdeeierlrsyarciglmfqvvddvldvtksseelgktag
kdliagkltyprlmgvekskeyaerlniearehllgfdidkvaplvsladyivnr

Sequence, based on observed residues (ATOM records): (download)

>d5e8kb_ a.128.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fkfmsymvnkaksvnkaleeavplrepelkireamrytllsdgkrvrpmlclaacelvgg
qestamsaacaiemlhasslilddlpcmdndslrrgkptnhivfgesiailasqaliala
vqkttsstfadvpperilktvqemvkaveglvagagegmrfdsdtglehlefihtaalle
aaavmgaimgggsdeeierlrsyarciglmfqvvddvldkltyprlmgvekskeyaerln
iearehllgfdidkvaplvsladyivnr

SCOPe Domain Coordinates for d5e8kb_:

Click to download the PDB-style file with coordinates for d5e8kb_.
(The format of our PDB-style files is described here.)

Timeline for d5e8kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5e8ka_