Lineage for d5e0kk_ (5e0k K:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435860Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2435890Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2435901Species Pyrococcus furiosus [TaxId:186497] [279285] (1 PDB entry)
  8. 2435907Domain d5e0kk_: 5e0k K: [279294]
    Other proteins in same PDB: d5e0kb_, d5e0kd_, d5e0kf_, d5e0kh_, d5e0kj_, d5e0kl_
    automated match to d1geqa_
    complexed with po4

Details for d5e0kk_

PDB Entry: 5e0k (more details), 2.76 Å

PDB Description: x-ray crystal structure of tryptophan synthase complex from pyrococcus furiosus at 2.76 a
PDB Compounds: (K:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5e0kk_:

Sequence, based on SEQRES records: (download)

>d5e0kk_ c.1.2.4 (K:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 186497]}
mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
kveellgi

Sequence, based on observed residues (ATOM records): (download)

>d5e0kk_ c.1.2.4 (K:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 186497]}
mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
hakefteiareegiktvflaapntpderlkviddmttgfvylvsleipktaydllrrakr
icrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveellgi

SCOPe Domain Coordinates for d5e0kk_:

Click to download the PDB-style file with coordinates for d5e0kk_.
(The format of our PDB-style files is described here.)

Timeline for d5e0kk_: