![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
![]() | Protein Trp synthase alpha-subunit [51388] (8 species) |
![]() | Species Pyrococcus furiosus [TaxId:186497] [279285] (1 PDB entry) |
![]() | Domain d5e0ki_: 5e0k I: [279293] Other proteins in same PDB: d5e0kb_, d5e0kd_, d5e0kf_, d5e0kh_, d5e0kj_, d5e0kl_ automated match to d1geqa_ complexed with po4 |
PDB Entry: 5e0k (more details), 2.76 Å
SCOPe Domain Sequences for d5e0ki_:
Sequence, based on SEQRES records: (download)
>d5e0ki_ c.1.2.4 (I:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 186497]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk kveellgi
>d5e0ki_ c.1.2.4 (I:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 186497]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeeipktaydllrra kricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveell gi
Timeline for d5e0ki_: