Lineage for d5e0kb_ (5e0k B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2514801Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2515084Protein automated matches [190054] (15 species)
    not a true protein
  7. 2515113Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries)
  8. 2515170Domain d5e0kb_: 5e0k B: [279283]
    Other proteins in same PDB: d5e0ka_, d5e0kc_, d5e0ke_, d5e0kg_, d5e0ki_, d5e0kk_
    automated match to d1v8zb_
    complexed with po4

Details for d5e0kb_

PDB Entry: 5e0k (more details), 2.76 Å

PDB Description: x-ray crystal structure of tryptophan synthase complex from pyrococcus furiosus at 2.76 a
PDB Compounds: (B:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5e0kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e0kb_ c.79.1.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d5e0kb_:

Click to download the PDB-style file with coordinates for d5e0kb_.
(The format of our PDB-style files is described here.)

Timeline for d5e0kb_: