SCOPe 2.05: Domain d5dw0a_: 5dw0 A:

Lineage for d5dw0a_ (5dw0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein automated matches [190054] (10 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [279274] (3 PDB entries)

8. Domain d5dw0a_: 5dw0 A: [279280]
   automated match to d1v8zb_
   complexed with na, pls

Details for d5dw0a_

PDB Entry: 5dw0, 2.01 Å

PDB Description: trpb from pyrococcus furiosus with l-serine bound as the external aldimine

PDB Compounds: (A:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5dw0a_:

Sequence; same for both SEQRES and ATOM records:

>d5dw0a_ c.79.1.1 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvsgnv

Timeline for d5dw0a_:

• d5dw0a_ is new in SCOPe 2.05-stable
  
• d5dw0a_ appears in SCOPe 2.06
  
• d5dw0a_ appears in the current release, SCOPe 2.08