Lineage for d5dw3c_ (5dw3 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2140010Protein automated matches [190054] (13 species)
    not a true protein
  7. 2140032Species Pyrococcus furiosus [TaxId:186497] [279274] (6 PDB entries)
  8. 2140035Domain d5dw3c_: 5dw3 C: [279276]
    automated match to d1v8zb_
    complexed with na, po4, trp

Details for d5dw3c_

PDB Entry: 5dw3 (more details), 1.74 Å

PDB Description: tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site
PDB Compounds: (C:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5dw3c_:

Sequence, based on SEQRES records: (download)

>d5dw3c_ c.79.1.1 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

Sequence, based on observed residues (ATOM records): (download)

>d5dw3c_ c.79.1.1 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdegqikpthsiapgldy
pgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakems
rdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d5dw3c_:

Click to download the PDB-style file with coordinates for d5dw3c_.
(The format of our PDB-style files is described here.)

Timeline for d5dw3c_: