![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein automated matches [190054] (13 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:186497] [279274] (16 PDB entries) |
![]() | Domain d5dw3c_: 5dw3 C: [279276] automated match to d1v8zb_ complexed with na, po4, trp |
PDB Entry: 5dw3 (more details), 1.74 Å
SCOPe Domain Sequences for d5dw3c_:
Sequence, based on SEQRES records: (download)
>d5dw3c_ c.79.1.1 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]} mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem srdeiiivnlsgrgdkdldivlkvs
>d5dw3c_ c.79.1.1 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]} mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdegqikpthsiapgldy pgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakems rdeiiivnlsgrgdkdldivlkvs
Timeline for d5dw3c_: