SCOPe 2.08: Domain d5d6cl1: 5d6c L:1-112

Lineage for d5d6cl1 (5d6c L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5d6cl1: 5d6c L:1-112 [279272]
   Other proteins in same PDB: d5d6ca2, d5d6cb_, d5d6ch_, d5d6cl2
   automated match to d1dn0a1
   complexed with 57s, act, ca, gol

Details for d5d6cl1

PDB Entry: 5d6c, 1.72 Å

PDB Description: structure of 4497 fab bound to synthetic wall teichoic acid fragment

PDB Compounds: (L:) 4497 antibody IgK (VL and CL)

SCOPe Domain Sequences for d5d6cl1:

Sequence; same for both SEQRES and ATOM records:

>d5d6cl1 b.1.1.0 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspdslavslgeratinckssqsifrtsrnknllnwyqqrpgqpprllihwastr
ksgvpdrfsgsgfgtdftltitslqaedvaiyycqqyfsppytfgqgtklei

Timeline for d5d6cl1:

• d5d6cl1 first appeared in SCOPe 2.05
  
• d5d6cl1 appears in SCOPe 2.07