Lineage for d5d73b2 (5d73 B:78-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713766Species Wuchereria bancrofti [TaxId:6293] [226430] (1 PDB entry)
  8. 2713768Domain d5d73b2: 5d73 B:78-208 [279269]
    Other proteins in same PDB: d5d73a1, d5d73b1
    automated match to d3t2ua2
    complexed with gsh

Details for d5d73b2

PDB Entry: 5d73 (more details), 2.33 Å

PDB Description: structure of wuchereria bancrofti pi-class glutathione s-transferase
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d5d73b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d73b2 a.45.1.1 (B:78-208) automated matches {Wuchereria bancrofti [TaxId: 6293]}
ggneletthidmfcegvrdlhtkytkmiyqaydtekdsyikdilpvelakfekllatrdd
gknfilgekisyvdfvlfeeldihqildphcldkfpllkayhqrmedrpglkeyckqrnr
akipvngngkq

SCOPe Domain Coordinates for d5d73b2:

Click to download the PDB-style file with coordinates for d5d73b2.
(The format of our PDB-style files is described here.)

Timeline for d5d73b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d73b1