SCOPe 2.08: Domain d5d73b2: 5d73 B:78-208

Lineage for d5d73b2 (5d73 B:78-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Wuchereria bancrofti [TaxId:6293] [226430] (1 PDB entry)

8. Domain d5d73b2: 5d73 B:78-208 [279269]
   Other proteins in same PDB: d5d73a1, d5d73b1
   automated match to d3t2ua2
   complexed with gsh

Details for d5d73b2

PDB Entry: 5d73, 2.33 Å

PDB Description: structure of wuchereria bancrofti pi-class glutathione s-transferase

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d5d73b2:

Sequence; same for both SEQRES and ATOM records:

>d5d73b2 a.45.1.1 (B:78-208) automated matches {Wuchereria bancrofti [TaxId: 6293]}
ggneletthidmfcegvrdlhtkytkmiyqaydtekdsyikdilpvelakfekllatrdd
gknfilgekisyvdfvlfeeldihqildphcldkfpllkayhqrmedrpglkeyckqrnr
akipvngngkq

Timeline for d5d73b2:

• d5d73b2 first appeared in SCOPe 2.05
  
• d5d73b2 appears in SCOPe 2.07