SCOPe 2.05: Domain d5d73b1: 5d73 B:2-77

Lineage for d5d73b1 (5d73 B:2-77)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Brugia malayi [TaxId:6279] [279264] (1 PDB entry)

8. Domain d5d73b1: 5d73 B:2-77 [279268]
   Other proteins in same PDB: d5d73a2, d5d73b2
   automated match to d3t2ua1
   complexed with gsh

Details for d5d73b1

PDB Entry: 5d73, 2.33 Å

PDB Description: structure of wuchereria bancrofti pi-class glutathione s-transferase

PDB Compounds: (B:) bma-gst-1

SCOPe Domain Sequences for d5d73b1:

Sequence; same for both SEQRES and ATOM records:

>d5d73b1 c.47.1.0 (B:2-77) automated matches {Brugia malayi [TaxId: 6279]}
sykltyfpirglaepirlvlvdqgikftddrinasdwpsmkshfhfgqlpclydgdhqiv
qsgailrhlarkhnln

Timeline for d5d73b1:

• d5d73b1 is new in SCOPe 2.05-stable
  
• d5d73b1 appears in SCOPe 2.06
  
• d5d73b1 appears in the current release, SCOPe 2.08