Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Brugia malayi [TaxId:6279] [279264] (1 PDB entry) |
Domain d5d73b1: 5d73 B:2-77 [279268] Other proteins in same PDB: d5d73a2, d5d73b2 automated match to d3t2ua1 complexed with gsh |
PDB Entry: 5d73 (more details), 2.33 Å
SCOPe Domain Sequences for d5d73b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d73b1 c.47.1.0 (B:2-77) automated matches {Brugia malayi [TaxId: 6279]} sykltyfpirglaepirlvlvdqgikftddrinasdwpsmkshfhfgqlpclydgdhqiv qsgailrhlarkhnln
Timeline for d5d73b1: