Lineage for d5d73a2 (5d73 A:78-208)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736229Protein automated matches [226848] (11 species)
    not a true protein
  7. 1736240Species Brugia malayi [TaxId:6279] [279266] (1 PDB entry)
  8. 1736241Domain d5d73a2: 5d73 A:78-208 [279267]
    Other proteins in same PDB: d5d73a1, d5d73b1
    automated match to d3t2ua2
    complexed with gsh

Details for d5d73a2

PDB Entry: 5d73 (more details), 2.33 Å

PDB Description: structure of wuchereria bancrofti pi-class glutathione s-transferase
PDB Compounds: (A:) bma-gst-1

SCOPe Domain Sequences for d5d73a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d73a2 a.45.1.1 (A:78-208) automated matches {Brugia malayi [TaxId: 6279]}
ggneletthidmfcegvrdlhtkytkmiyqaydtekdsyikdilpvelakfekllatrdd
gknfilgekisyvdfvlfeeldihqildphcldkfpllkayhqrmedrpglkeyckqrnr
akipvngngkq

SCOPe Domain Coordinates for d5d73a2:

Click to download the PDB-style file with coordinates for d5d73a2.
(The format of our PDB-style files is described here.)

Timeline for d5d73a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d73a1