Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (11 species) not a true protein |
Species Brugia malayi [TaxId:6279] [279266] (1 PDB entry) |
Domain d5d73a2: 5d73 A:78-208 [279267] Other proteins in same PDB: d5d73a1, d5d73b1 automated match to d3t2ua2 complexed with gsh |
PDB Entry: 5d73 (more details), 2.33 Å
SCOPe Domain Sequences for d5d73a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d73a2 a.45.1.1 (A:78-208) automated matches {Brugia malayi [TaxId: 6279]} ggneletthidmfcegvrdlhtkytkmiyqaydtekdsyikdilpvelakfekllatrdd gknfilgekisyvdfvlfeeldihqildphcldkfpllkayhqrmedrpglkeyckqrnr akipvngngkq
Timeline for d5d73a2: