Lineage for d5d73a1 (5d73 A:2-77)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2135174Species Wuchereria bancrofti [TaxId:6293] [226429] (1 PDB entry)
  8. 2135175Domain d5d73a1: 5d73 A:2-77 [279265]
    Other proteins in same PDB: d5d73a2, d5d73b2
    automated match to d3t2ua1
    complexed with gsh

Details for d5d73a1

PDB Entry: 5d73 (more details), 2.33 Å

PDB Description: structure of wuchereria bancrofti pi-class glutathione s-transferase
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d5d73a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d73a1 c.47.1.0 (A:2-77) automated matches {Wuchereria bancrofti [TaxId: 6293]}
sykltyfpirglaepirlvlvdqgikftddrinasdwpsmkshfhfgqlpclydgdhqiv
qsgailrhlarkhnln

SCOPe Domain Coordinates for d5d73a1:

Click to download the PDB-style file with coordinates for d5d73a1.
(The format of our PDB-style files is described here.)

Timeline for d5d73a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d73a2