SCOPe 2.05: Domain d5dfda_: 5dfd A:

Lineage for d5dfda_ (5dfd A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d5dfda_: 5dfd A: [279261]
   automated match to d4j1pa_
   complexed with 59e, gol; mutant

Details for d5dfda_

PDB Entry: 5dfd, 1.5 Å

PDB Description: crystal structure of brd2(bd2) w370f mutant with ligand 28 bound

PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d5dfda_:

Sequence; same for both SEQRES and ATOM records:

>d5dfda_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seqlkhcngilkellskkhaayafpfykpvdasalglhdyhdiikhpmdlstvkrkmenr
dyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp

Timeline for d5dfda_:

• d5dfda_ is new in SCOPe 2.05-stable
  
• d5dfda_ appears in SCOPe 2.06
  
• d5dfda_ appears in the current release, SCOPe 2.08