| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins) automatically mapped to Pfam PF07737 |
| Protein automated matches [234341] (1 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234342] (14 PDB entries) |
| Domain d5d1ua2: 5d1u A:551-776 [279258] Other proteins in same PDB: d5d1ua1 automated match to d1j7na2 complexed with 56p, zn |
PDB Entry: 5d1u (more details), 2.85 Å
SCOPe Domain Sequences for d5d1ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d1ua2 d.92.1.14 (A:551-776) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins
Timeline for d5d1ua2: