![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein automated matches [190133] (8 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234339] (15 PDB entries) |
![]() | Domain d5d1ua1: 5d1u A:267-550 [279257] Other proteins in same PDB: d5d1ua2 automated match to d1j7na3 complexed with 56p, zn |
PDB Entry: 5d1u (more details), 2.85 Å
SCOPe Domain Sequences for d5d1ua1:
Sequence, based on SEQRES records: (download)
>d5d1ua1 d.166.1.1 (A:267-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqids sdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiqpy dinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninnl tatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriqls pdtragylengklilqrnigleikdvqiikqsekeyiridakvv
>d5d1ua1 d.166.1.1 (A:267-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqids sdflsteekeflkklqidilsekekeflkklkldiqpydinqrlqdtgglidspsinldv rkqykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvdstdntkinrgif nefkknfkysissnymivdinerpaldnerlkwriqlspdtragylengklilqrnigle ikdvqiikqsekeyiridakvv
Timeline for d5d1ua1: