SCOPe 2.08: Domain d5d1sa2: 5d1s A:551-776

Lineage for d5d1sa2 (5d1s A:551-776)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
   automatically mapped to Pfam PF07737

6. Protein automated matches [234341] (1 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234342] (14 PDB entries)

8. Domain d5d1sa2: 5d1s A:551-776 [279254]
   Other proteins in same PDB: d5d1sa1
   automated match to d1j7na2
   complexed with 56q, zn

Details for d5d1sa2

PDB Entry: 5d1s, 2.1 Å

PDB Description: anthrax toxin lethal factor with hydroxamic acid inhibitor

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d5d1sa2:

Sequence; same for both SEQRES and ATOM records:

>d5d1sa2 d.92.1.14 (A:551-776) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

Timeline for d5d1sa2:

• d5d1sa2 first appeared in SCOPe 2.05
  
• d5d1sa2 appears in SCOPe 2.07