SCOPe 2.08: Domain d5cgyl2: 5cgy L:111-213

Lineage for d5cgyl2 (5cgy L:111-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5cgyl2: 5cgy L:111-213 [279252]
   Other proteins in same PDB: d5cgyc_, d5cgyd1, d5cgyh_, d5cgyl1
   automated match to d4ocrl2

Details for d5cgyl2

PDB Entry: 5cgy, 2.07 Å

PDB Description: fab fragment of chikungunya virus neutralizing human monoclonal antibody 4j21

PDB Compounds: (L:) Light Chain of Fab

SCOPe Domain Sequences for d5cgyl2:

Sequence; same for both SEQRES and ATOM records:

>d5cgyl2 b.1.1.2 (L:111-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrqpkaaptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshksyscqvthegstvektvap

Timeline for d5cgyl2:

• d5cgyl2 first appeared in SCOPe 2.05
  
• d5cgyl2 appears in SCOPe 2.07