SCOP 1.73: Domain d1cvaa_: 1cva A:

Lineage for d1cvaa_ (1cva A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (197 PDB entries)

8. Domain d1cvaa_: 1cva A: [27925]
   complexed with azi, zn; mutant

Details for d1cvaa_

PDB Entry: 1cva, 2.25 Å

PDB Description: structural and functional importance of a conserved hydrogen bond network in human carbonic anhydrase ii

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1cvaa_:

Sequence; same for both SEQRES and ATOM records:

>d1cvaa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslvtppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1cvaa_:

• d1cvaa_ first appeared (with stable ids) in SCOP 1.55, called d1cva__
  
• d1cvaa_ was called d1cva__ in SCOP 1.71
  
• d1cvaa_ appears in SCOP 1.75
  
• d1cvaa_ appears in the current release, SCOPe 2.08