SCOPe 2.06: Domain d5cgyd1: 5cgy D:2-110

Lineage for d5cgyd1 (5cgy D:2-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5cgyd1: 5cgy D:2-110 [279249]
   Other proteins in same PDB: d5cgyd2, d5cgyl2
   automated match to d4ocrl1

Details for d5cgyd1

PDB Entry: 5cgy, 2.07 Å

PDB Description: fab fragment of chikungunya virus neutralizing human monoclonal antibody 4j21

PDB Compounds: (D:) Light Chain of Fab

SCOPe Domain Sequences for d5cgyd1:

Sequence; same for both SEQRES and ATOM records:

>d5cgyd1 b.1.1.0 (D:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svvtqppsvsgtpgqgvtiscsggssnigsnpvnwyqmvpgtapklllytnnqrpsgvpd
rfsgsksgtsaslainglqsedeadyycavwddslsgrwvfgggtkvtv

Timeline for d5cgyd1:

• d5cgyd1 first appeared in SCOPe 2.05
  
• d5cgyd1 appears in SCOPe 2.07
  
• d5cgyd1 appears in the current release, SCOPe 2.08