SCOPe 2.08: Domain d5chnb1: 5chn B:2-112

Lineage for d5chnb1 (5chn B:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5chnb1: 5chn B:2-112 [279245]
   Other proteins in same PDB: d5chnb2, d5chnl2
   automated match to d3cfja1

Details for d5chnb1

PDB Entry: 5chn, 2.05 Å

PDB Description: fab fragments of chikungunya virus neutralizing human monoclonal antibody 5m16

PDB Compounds: (B:) Antibody 5M16 Fab Light Chain

SCOPe Domain Sequences for d5chnb1:

Sequence; same for both SEQRES and ATOM records:

>d5chnb1 b.1.1.0 (B:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivmtqtplslsvtpgqpasisckssqsllhsdgktylywylqkpgqspqlliyevsnrls
gvpdrfsgsgsgtdftlkisrvetedvgvyycmqsiqvplytfgqgtrlei

Timeline for d5chnb1:

• d5chnb1 first appeared in SCOPe 2.05
  
• d5chnb1 appears in SCOPe 2.07