Lineage for d5csjb_ (5csj B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733398Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1733399Protein Calcyclin (S100) [47479] (17 species)
  7. 1733552Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries)
  8. 1733563Domain d5csjb_: 5csj B: [279244]
    automated match to d3d10a_
    complexed with ca, cl

Details for d5csjb_

PDB Entry: 5csj (more details), 2.7 Å

PDB Description: s100b-rsk1 crystal structure b
PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d5csjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5csjb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
hmselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvme
tldndgdgecdfqefmafvamvttacheff

SCOPe Domain Coordinates for d5csjb_:

Click to download the PDB-style file with coordinates for d5csjb_.
(The format of our PDB-style files is described here.)

Timeline for d5csjb_: