![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries) |
![]() | Domain d5csib1: 5csi B:0-88 [279240] Other proteins in same PDB: d5csia2, d5csib2 automated match to d3d10a_ complexed with ca |
PDB Entry: 5csi (more details), 2.13 Å
SCOPe Domain Sequences for d5csib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5csib1 a.39.1.2 (B:0-88) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]} mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet ldndgdgecdfqefmafvamvttacheff
Timeline for d5csib1: