Lineage for d5azel1 (5aze L:2-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756816Domain d5azel1: 5aze L:2-111 [279231]
    Other proteins in same PDB: d5azel2
    automated match to d3n9gl1
    complexed with ca

Details for d5azel1

PDB Entry: 5aze (more details), 2.2 Å

PDB Description: fab fragment of calcium-dependent antigen binding antibody, 6rl#9
PDB Compounds: (L:) 6rl#9 fab light chain

SCOPe Domain Sequences for d5azel1:

Sequence, based on SEQRES records: (download)

>d5azel1 b.1.1.0 (L:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgsrsnmgagydvhwyqllpgaapkllishnthrpsgvp
drfsgsksgasaslaitglqaedeadyycqshdsslsavvfgggtkltvl

Sequence, based on observed residues (ATOM records): (download)

>d5azel1 b.1.1.0 (L:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgdvhwyqllpgaapkllishnthrpsgvpdrfsgsksg
asaslaitglqaedeadyycqshdsslsavvfgggtkltvl

SCOPe Domain Coordinates for d5azel1:

Click to download the PDB-style file with coordinates for d5azel1.
(The format of our PDB-style files is described here.)

Timeline for d5azel1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5azel2
View in 3D
Domains from other chains:
(mouse over for more information)
d5azeh_