Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d5bxfa2: 5bxf A:177-267 [279228] Other proteins in same PDB: d5bxfa1, d5bxfb_, d5bxfc1, d5bxfd_ automated match to d3frua1 |
PDB Entry: 5bxf (more details), 2.85 Å
SCOPe Domain Sequences for d5bxfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxfa2 b.1.1.2 (A:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]} keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha sssltvksgdehhyccivqhaglaqplrvel
Timeline for d5bxfa2:
View in 3D Domains from other chains: (mouse over for more information) d5bxfb_, d5bxfc1, d5bxfc2, d5bxfd_ |