| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d5bxfa1: 5bxf A:5-176 [279227] Other proteins in same PDB: d5bxfa2, d5bxfb_, d5bxfc2, d5bxfd_ automated match to d3frua2 |
PDB Entry: 5bxf (more details), 2.85 Å
SCOPe Domain Sequences for d5bxfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxfa1 d.19.1.0 (A:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke
ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq
gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
Timeline for d5bxfa1:
View in 3DDomains from other chains: (mouse over for more information) d5bxfb_, d5bxfc1, d5bxfc2, d5bxfd_ |