SCOPe 2.08: Domain d5bxfc1: 5bxf C:5-176

Lineage for d5bxfc1 (5bxf C:5-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d5bxfc1: 5bxf C:5-176 [279225]
   Other proteins in same PDB: d5bxfa2, d5bxfb_, d5bxfc2, d5bxfd_
   automated match to d3frua2

Details for d5bxfc1

PDB Entry: 5bxf, 2.85 Å

PDB Description: apo fcrn structure at ph 4.5

PDB Compounds: (C:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d5bxfc1:

Sequence; same for both SEQRES and ATOM records:

>d5bxfc1 d.19.1.0 (C:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke
ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq
gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

Timeline for d5bxfc1:

• d5bxfc1 first appeared in SCOPe 2.05
  
• d5bxfc1 appears in SCOPe 2.07