SCOP 1.73: Domain d1ugga_: 1ugg A:

Lineage for d1ugga_ (1ugg A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (197 PDB entries)

8. Domain d1ugga_: 1ugg A: [27922]
   complexed with zn; mutant

Details for d1ugga_

PDB Entry: 1ugg, 2.2 Å

PDB Description: human carbonic anhydrase ii[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by ser (a65s)-orthorhombic form

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1ugga_:

Sequence; same for both SEQRES and ATOM records:

>d1ugga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghsfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1ugga_:

• d1ugga_ first appeared (with stable ids) in SCOP 1.55, called d1ugg__
  
• d1ugga_ was called d1ugg__ in SCOP 1.71
  
• d1ugga_ appears in SCOP 1.75
  
• d1ugga_ appears in the current release, SCOPe 2.08