SCOP 1.71: Domain d1ugg__: 1ugg -

Lineage for d1ugg__ (1ugg -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (154 PDB entries)

8. Domain d1ugg__: 1ugg - [27922]
   complexed with zn; mutant

Details for d1ugg__

PDB Entry: 1ugg, 2.2 Å

PDB Description: human carbonic anhydrase ii[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by ser (a65s)-orthorhombic form

SCOP Domain Sequences for d1ugg__:

Sequence; same for both SEQRES and ATOM records:

>d1ugg__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghsfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1ugg__:

• d1ugg__ first appeared (with stable ids) in SCOP 1.55
  
• d1ugg__ appears in SCOP 1.69
  
• d1ugg__ is called d1ugga_ in SCOP 1.73
  
• d1ugg__ appears in the current release, SCOPe 2.08, called d1ugga_