Lineage for d1ugg__ (1ugg -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63199Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 63200Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 63201Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 63202Protein Carbonic anhydrase [51071] (9 species)
  7. 63217Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (143 PDB entries)
  8. 63336Domain d1ugg__: 1ugg - [27922]

Details for d1ugg__

PDB Entry: 1ugg (more details), 2.2 Å

PDB Description: human carbonic anhydrase ii[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by ser (a65s)-orthorhombic form

SCOP Domain Sequences for d1ugg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugg__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghsfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOP Domain Coordinates for d1ugg__:

Click to download the PDB-style file with coordinates for d1ugg__.
(The format of our PDB-style files is described here.)

Timeline for d1ugg__: