SCOPe 2.07: Domain d5byrb1: 5byr B:2-126

Lineage for d5byrb1 (5byr B:2-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries)

8. Domain d5byrb1: 5byr B:2-126 [279216]
   Other proteins in same PDB: d5byra2, d5byra3, d5byrb2, d5byrb3
   automated match to d3c8ya2
   complexed with 4ww, fes, gol, mg, sf4

Details for d5byrb1

PDB Entry: 5byr, 1.82 Å

PDB Description: semisynthetic [fefe]-hydrogenase cpi with propane-dithiolato-bridged [2fe] cofactor

PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5byrb1:

Sequence; same for both SEQRES and ATOM records:

>d5byrb1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp

Timeline for d5byrb1:

• d5byrb1 first appeared in SCOPe 2.05
  
• d5byrb1 appears in SCOPe 2.06
  
• d5byrb1 appears in the current release, SCOPe 2.08