Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
Protein automated matches [229599] (3 species) not a true protein |
Species Clostridium pasteurianum [TaxId:1501] [279205] (7 PDB entries) |
Domain d5byqa2: 5byq A:127-209 [279211] Other proteins in same PDB: d5byqa1, d5byqa3, d5byqa4, d5byqb1, d5byqb3, d5byqb4 automated match to d3c8ya3 complexed with 4wv, fes, gol, mg, sf4 |
PDB Entry: 5byq (more details), 1.73 Å
SCOPe Domain Sequences for d5byqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5byqa2 d.58.1.0 (A:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]} kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd dtncllcgqciiacpvaalseks
Timeline for d5byqa2:
View in 3D Domains from other chains: (mouse over for more information) d5byqb1, d5byqb2, d5byqb3, d5byqb4 |