Lineage for d5bsfi2 (5bsf I:170-274)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721784Species Medicago truncatula [TaxId:3880] [279125] (4 PDB entries)
  8. 2721803Domain d5bsfi2: 5bsf I:170-274 [279200]
    Other proteins in same PDB: d5bsfa1, d5bsfb1, d5bsfc1, d5bsfd1, d5bsfe1, d5bsff1, d5bsfg1, d5bsfh1, d5bsfi1, d5bsfj1
    automated match to d2izza2
    complexed with cl, mpo, nad

Details for d5bsfi2

PDB Entry: 5bsf (more details), 1.85 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with nad+
PDB Compounds: (I:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bsfi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bsfi2 a.100.1.0 (I:170-274) automated matches {Medicago truncatula [TaxId: 3880]}
kyfdaitglsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhp
gqlkddvtspggttiagvhelekagfrgilmnavvaaakrsqels

SCOPe Domain Coordinates for d5bsfi2:

Click to download the PDB-style file with coordinates for d5bsfi2.
(The format of our PDB-style files is described here.)

Timeline for d5bsfi2: