| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (203 species) not a true protein |
| Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries) |
| Domain d5bsfh1: 5bsf H:3-169 [279197] Other proteins in same PDB: d5bsfa2, d5bsfb2, d5bsfc2, d5bsfd2, d5bsfe2, d5bsff2, d5bsfg2, d5bsfh2, d5bsfi2, d5bsfj2 automated match to d2izzd1 complexed with cl, mpo, nad |
PDB Entry: 5bsf (more details), 1.85 Å
SCOPe Domain Sequences for d5bsfh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bsfh1 c.2.1.0 (H:3-169) automated matches {Medicago truncatula [TaxId: 3880]}
iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd
Timeline for d5bsfh1: