| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Medicago truncatula [TaxId:3880] [279125] (4 PDB entries) |
| Domain d5bsff2: 5bsf F:170-274 [279196] Other proteins in same PDB: d5bsfa1, d5bsfb1, d5bsfc1, d5bsfd1, d5bsfe1, d5bsff1, d5bsfg1, d5bsfh1, d5bsfi1, d5bsfj1 automated match to d2izza2 complexed with cl, mpo, nad |
PDB Entry: 5bsf (more details), 1.85 Å
SCOPe Domain Sequences for d5bsff2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bsff2 a.100.1.0 (F:170-274) automated matches {Medicago truncatula [TaxId: 3880]}
kyfdaitglsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhp
gqlkddvtspggttiagvhelekagfrgilmnavvaaakrsqels
Timeline for d5bsff2: