Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries) |
Domain d5bshj1: 5bsh J:4-169 [279181] Other proteins in same PDB: d5bsha2, d5bshb2, d5bshc2, d5bshd2, d5bshe2, d5bshf2, d5bshg2, d5bshh2, d5bshi2, d5bshj2 automated match to d2izzd1 complexed with pro |
PDB Entry: 5bsh (more details), 2.1 Å
SCOPe Domain Sequences for d5bshj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bshj1 c.2.1.0 (J:4-169) automated matches {Medicago truncatula [TaxId: 3880]} ipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvls snddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfi rvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd
Timeline for d5bshj1: