Lineage for d5bshj1 (5bsh J:4-169)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847526Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries)
  8. 2847568Domain d5bshj1: 5bsh J:4-169 [279181]
    Other proteins in same PDB: d5bsha2, d5bshb2, d5bshc2, d5bshd2, d5bshe2, d5bshf2, d5bshg2, d5bshh2, d5bshi2, d5bshj2
    automated match to d2izzd1
    complexed with pro

Details for d5bshj1

PDB Entry: 5bsh (more details), 2.1 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline
PDB Compounds: (J:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bshj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bshj1 c.2.1.0 (J:4-169) automated matches {Medicago truncatula [TaxId: 3880]}
ipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvls
snddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfi
rvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd

SCOPe Domain Coordinates for d5bshj1:

Click to download the PDB-style file with coordinates for d5bshj1.
(The format of our PDB-style files is described here.)

Timeline for d5bshj1: