SCOPe 2.08: Domain d5bshi2: 5bsh I:170-274

Lineage for d5bshi2 (5bsh I:170-274)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [279125] (4 PDB entries)

8. Domain d5bshi2: 5bsh I:170-274 [279180]
   Other proteins in same PDB: d5bsha1, d5bshb1, d5bshc1, d5bshd1, d5bshe1, d5bshf1, d5bshg1, d5bshh1, d5bshi1, d5bshj1
   automated match to d2izza2
   complexed with pro

Details for d5bshi2

PDB Entry: 5bsh, 2.1 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline

PDB Compounds: (I:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bshi2:

Sequence; same for both SEQRES and ATOM records:

>d5bshi2 a.100.1.0 (I:170-274) automated matches {Medicago truncatula [TaxId: 3880]}
kyfdaitglsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhp
gqlkddvtspggttiagvhelekagfrgilmnavvaaakrsqels

Timeline for d5bshi2:

• d5bshi2 first appeared in SCOPe 2.05
  
• d5bshi2 appears in SCOPe 2.07