| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (203 species) not a true protein |
| Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries) |
| Domain d5bshg1: 5bsh G:7-169 [279177] Other proteins in same PDB: d5bsha2, d5bshb2, d5bshc2, d5bshd2, d5bshe2, d5bshf2, d5bshg2, d5bshh2, d5bshi2, d5bshj2 automated match to d2izzd1 complexed with pro |
PDB Entry: 5bsh (more details), 2.1 Å
SCOPe Domain Sequences for d5bshg1:
Sequence, based on SEQRES records: (download)
>d5bshg1 c.2.1.0 (G:7-169) automated matches {Medicago truncatula [TaxId: 3880]}
padsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlssnd
dvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvm
pntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd
>d5bshg1 c.2.1.0 (G:7-169) automated matches {Medicago truncatula [TaxId: 3880]}
padsytlgfigagkmaesiakgavrsgvlspsriktaarrtafesigitvlssnddvvrd
snvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvmpntaa
tvgeaasvmslggaateedanlisqlfgsigkiwkadd
Timeline for d5bshg1: