Lineage for d5bshc2 (5bsh C:170-274)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334882Species Medicago truncatula [TaxId:3880] [279125] (4 PDB entries)
  8. 2334915Domain d5bshc2: 5bsh C:170-274 [279174]
    Other proteins in same PDB: d5bsha1, d5bshb1, d5bshc1, d5bshd1, d5bshe1, d5bshf1, d5bshg1, d5bshh1, d5bshi1, d5bshj1
    automated match to d2izza2
    complexed with pro

Details for d5bshc2

PDB Entry: 5bsh (more details), 2.1 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline
PDB Compounds: (C:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bshc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bshc2 a.100.1.0 (C:170-274) automated matches {Medicago truncatula [TaxId: 3880]}
kyfdaitglsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhp
gqlkddvtspggttiagvhelekagfrgilmnavvaaakrsqels

SCOPe Domain Coordinates for d5bshc2:

Click to download the PDB-style file with coordinates for d5bshc2.
(The format of our PDB-style files is described here.)

Timeline for d5bshc2: