SCOPe 2.08: Domain d5bshc1: 5bsh C:5-169

Lineage for d5bshc1 (5bsh C:5-169)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries)

8. Domain d5bshc1: 5bsh C:5-169 [279173]
   Other proteins in same PDB: d5bsha2, d5bshb2, d5bshc2, d5bshd2, d5bshe2, d5bshf2, d5bshg2, d5bshh2, d5bshi2, d5bshj2
   automated match to d2izzd1
   complexed with pro

Details for d5bshc1

PDB Entry: 5bsh, 2.1 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline

PDB Compounds: (C:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bshc1:

Sequence, based on SEQRES records:

>d5bshc1 c.2.1.0 (C:5-169) automated matches {Medicago truncatula [TaxId: 3880]}
pipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlss
nddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfir
vmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd

Sequence, based on observed residues (ATOM records):

>d5bshc1 c.2.1.0 (C:5-169) automated matches {Medicago truncatula [TaxId: 3880]}
pipadsytlgfigagkmaesiakgavrsgvlspsriktasnparrtafesigitvlssnd
dvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvm
pntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd

Timeline for d5bshc1:

• d5bshc1 first appeared in SCOPe 2.05
  
• d5bshc1 appears in SCOPe 2.07