Lineage for d5bsea1 (5bse A:3-169)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455883Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries)
  8. 2455884Domain d5bsea1: 5bse A:3-169 [279149]
    Other proteins in same PDB: d5bsea2, d5bseb2, d5bsec2, d5bsed2, d5bsee2, d5bsef2, d5bseg2, d5bseh2, d5bsei2, d5bsej2
    automated match to d2izzd1
    complexed with cl, mpo

Details for d5bsea1

PDB Entry: 5bse (more details), 1.7 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr)
PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bsea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bsea1 c.2.1.0 (A:3-169) automated matches {Medicago truncatula [TaxId: 3880]}
iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd

SCOPe Domain Coordinates for d5bsea1:

Click to download the PDB-style file with coordinates for d5bsea1.
(The format of our PDB-style files is described here.)

Timeline for d5bsea1: