| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries) |
| Domain d5bsec1: 5bse C:3-169 [279142] Other proteins in same PDB: d5bsea2, d5bseb2, d5bsec2, d5bsed2, d5bsee2, d5bsef2, d5bseg2, d5bseh2, d5bsei2, d5bsej2 automated match to d2izzd1 complexed with cl, mpo |
PDB Entry: 5bse (more details), 1.7 Å
SCOPe Domain Sequences for d5bsec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bsec1 c.2.1.0 (C:3-169) automated matches {Medicago truncatula [TaxId: 3880]}
iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd
Timeline for d5bsec1: