SCOPe 2.05: Domain d5axqb_: 5axq B:

Lineage for d5axqb_ (5axq B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d5axqb_: 5axq B: [279119]
   automated match to d4lm1a_
   complexed with 4lk, 4lp, mg, zn

Details for d5axqb_

PDB Entry: 5axq, 1.77 Å

PDB Description: crystal structure of the catalytic domain of pde10a complexed with highly potent and brain-penetrant pde10a inhibitor with 2-oxindole scaffold

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5axqb_:

Sequence; same for both SEQRES and ATOM records:

>d5axqb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
crdnlsqwekvirgee

Timeline for d5axqb_:

• d5axqb_ is new in SCOPe 2.05-stable
  
• d5axqb_ appears in SCOPe 2.06
  
• d5axqb_ appears in the current release, SCOPe 2.08